| 产品详情 |
| Edit |   |
| Antigenic Specificity | RBP7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RBP7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBP7. This antibody reacts with human, mouse, rat. The RBP7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat RBP7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEK |
| Other Names | Cellular retinoic acid-binding protein 4, Cellular retinoic acid-binding protein IV, CRABP4, CRABP-IV, CRBP4, CRBPIV, MGC70641, putative cellular retinol-binding protein CRBP IV, retinoid binding protein 7, retinoid-binding protein 7, retinol binding protein 7, cellular |
| Gene, Accession # | RBP7, Gene ID: 116362 |
| Catalog # | NBP1-84383 |
| Price | |
| Order / More Info | RBP7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|