| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Bcl-xL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Bcl-xL Antibody from Novus Biologicals is a rabbit polyclonal antibody to Bcl-xL. This antibody reacts with human. The Bcl-xL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Bcl-xL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG |
|---|
| Other Names | Apoptosis regulator Bcl-X, bcl2-L-1, BCL2-like 1, bcl-2-like protein 1, BCLXBCL2LBcl-X, bcl-xL, BCLXL, BCL-XL/S, bcl-xS, BCLXS, DKFZp781P2092 |
|---|
| Gene, Accession # | BCL2L1, Gene ID: 598, Accession: Q07817, SwissProt: Q07817 |
|---|
| Catalog # | NBP2-38262 |
|---|
| Price | |
|---|
| Order / More Info | Bcl-xL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|