| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNAH6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNAH6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNAH6. This antibody reacts with human. The DNAH6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DNAH6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPWERIIPTFKYNRDVP |
|---|
| Other Names | axonemal, Ciliary dynein heavy chain 6, DNAHC6, DNHL1, dynein heavy chain-like 1, dynein, axonemal, heavy chain 6, dynein, axonemal, heavy polypeptide 6, FLJ23529, FLJ37357, HL-2, HL2DKFZp667K087, KIAA1697, MGC132544, MGC141984, MGC177197 |
|---|
| Gene, Accession # | DNAH6, Gene ID: 1768 |
|---|
| Catalog # | NBP1-84067 |
|---|
| Price | |
|---|
| Order / More Info | DNAH6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|