| 产品详情 |
| Edit |   |
| Antigenic Specificity | DNAH5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IP reported in the scientific literature (PMID: 25232951). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DNAH5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNAH5. This antibody reacts with human. The DNAH5 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. Specificity of human DNAH5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD |
| Other Names | Axonemal beta dynein heavy chain 5, CILD3KIAA1603, Ciliary dynein heavy chain 5, dynein heavy chain 5, axonemal, dynein, axonemal, heavy chain 5, dynein, axonemal, heavy polypeptide 5, FLJ46759, HL1DNAHC5, KTGNR, PCDDnahc5 |
| Gene, Accession # | DNAH5, Gene ID: 1767 |
| Catalog # | NBP1-84463 |
| Price | |
| Order / More Info | DNAH5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24203976, 24518672, 25232951 |
| 产品资料 |
|
|