| 产品详情 |
| Edit |   |
| Antigenic Specificity | 15-PGDH/HPGD |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The 15-PGDH/HPGD Antibody from Novus Biologicals is a rabbit polyclonal antibody to 15-PGDH/HPGD. This antibody reacts with human. The 15-PGDH/HPGD Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human 15-PGDH/HPGD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGI |
| Other Names | 15-hydroxyprostaglandin dehydrogenase [NAD+], 15-PGDH, EC 1.1.1, EC 1.1.1.141, hydroxyprostaglandin dehydrogenase 15-(NAD), NAD+-dependent 15-hydroxyprostaglandin dehydrogenase, PGDH1PGDH, Prostaglandin dehydrogenase 1, SDR36C1, short chain dehydrogenase/reductase family 36C, member 1 |
| Gene, Accession # | HPGD, Gene ID: 3248 |
| Catalog # | NBP1-87061 |
| Price | |
| Order / More Info | 15-PGDH/HPGD Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|