| Edit |   |
|---|
| Antigenic Specificity | PGCP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PGCP Antibody from Novus Biologicals is a rabbit polyclonal antibody to PGCP. This antibody reacts with human. The PGCP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PGCP(plasma glutamate carboxypeptidase) The peptide sequence was selected from the N terminal of PGCP. Peptide sequence VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA. |
|---|
| Other Names | aminopeptidase, EC 3.4.17, EC 3.4.17.-, plasma glutamate carboxypeptidase |
|---|
| Gene, Accession # | CPQ, Gene ID: 10404, Accession: Q9Y646, SwissProt: Q9Y646 |
|---|
| Catalog # | NBP1-58037-20ul |
|---|
| Price | |
|---|
| Order / More Info | PGCP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|