| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Collagen XXI |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Collagen XXI Antibody from Novus Biologicals is a rabbit polyclonal antibody to Collagen XXI. This antibody reacts with human. The Collagen XXI Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Collagen XXI antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AKSSRFLTKIAVVLTDGKSQDDVKDAAQAARDSKITLFAIGVGSETEDAELRAIANKPSSTYVFYVEDYIAISKIREVMK |
|---|
| Other Names | alpha 1 chain-like collagen, alpha 1 type XXI collagen, COL1AL, COLA1L, Collagen 21, collagen alpha-1(XXI) chain, collagen, type XXI, alpha 1, Collagen-21, dJ682J15.1, dJ708F5.1, DKFZp564B052, FLJ39125, FLJ44623, MGC26619 |
|---|
| Gene, Accession # | COL21A1, Gene ID: 81578, Accession: Q96P44, SwissProt: Q96P44 |
|---|
| Catalog # | NBP1-91015 |
|---|
| Price | |
|---|
| Order / More Info | Collagen XXI Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|