| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Collagen XII alpha1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Collagen XII alpha1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Collagen XII alpha1. This antibody reacts with human. The Collagen XII alpha1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Collagen XII alpha1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TGYKVILTPMTAGSRQHALSVGPQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIMEKTQPMKVQVECSR |
|---|
| Other Names | BA209D8.1, COL12A1L, collagen alpha-1(XII) chain, collagen type XII proteoglycan, collagen, type XII, alpha 1, DJ234P15.1, type XII, alpha 1-like |
|---|
| Gene, Accession # | COL12A1, Gene ID: 1303 |
|---|
| Catalog # | NBP2-57420 |
|---|
| Price | |
|---|
| Order / More Info | Collagen XII alpha1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|