| Edit |   |
|---|
| Antigenic Specificity | FAM135B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM135B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM135B. This antibody reacts with human. The FAM135B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human FAM135BThe immunogen for this antibody is FAM135B. Peptide sequence TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV. |
|---|
| Other Names | family with sequence similarity 135, member B, MGC126009 |
|---|
| Gene, Accession # | FAM135B, Gene ID: 51059, Accession: NP_056996, SwissProt: NP_056996 |
|---|
| Catalog # | NBP1-79643-20ul |
|---|
| Price | |
|---|
| Order / More Info | FAM135B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|