| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FAM119B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM119B Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM119B. This antibody reacts with human. The FAM119B Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FAM119B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQR DEDENVNIYRARHREPRPA |
|---|
| Other Names | DKFZP586D0919, EC 2.1.1.-, FAM119B, family with sequence similarity 119, member B, HCA557A, Hepatocellular carcinoma-associated antigen 557a, hepatocellularcarcinoma-associated antigen HCA557a, hypothetical protein LOC25895, methyltransferase like 21B |
|---|
| Gene, Accession # | METTL21B, Gene ID: 25895 |
|---|
| Catalog # | NBP2-14233 |
|---|
| Price | |
|---|
| Order / More Info | FAM119B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|