| Edit |   |
| Antigenic Specificity | GADL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GADL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GADL1. This antibody reacts with human. The GADL1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human GADL1The immunogen for this antibody is GADL1. Peptide sequence SAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGA. |
| Other Names | glutamate decarboxylase-like 1, MGC138191 |
| Gene, Accession # | GADL1, Gene ID: 339896, Accession: NP_997242, SwissProt: NP_997242 |
| Catalog # | NBP1-79612-20ul |
| Price | |
| Order / More Info | GADL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |