| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RASSF7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RASSF7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RASSF7. This antibody reacts with human. The RASSF7 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RASSF7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QATCGQFASDVQFVLRRTGPSLAGRPSSDSCPPPERCLIRASLPVKPRAALGCEPRKTLTPEPAPSLSRPGP |
|---|
| Other Names | chromosome 11 open reading frame 13, HRAS1-related cluster protein 1, HRAS1-related cluster-1, HRC1C11orf13HRAS1, MGC126069, MGC126070, Ras association (RalGDS/AF-6) domain family (N-terminal) member 7, Ras association (RalGDS/AF-6) domain family 7, ras association domain-containing protein 7 |
|---|
| Gene, Accession # | RASSF7, Gene ID: 8045 |
|---|
| Catalog # | NBP2-58860 |
|---|
| Price | |
|---|
| Order / More Info | RASSF7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|