| Edit |   |
| Antigenic Specificity | RASSF6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RASSF6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RASSF6. This antibody reacts with human. The RASSF6 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RASSF6 (Ras association (RalGDS/AF-6) domain family member 6) The peptide sequence was selected from the middle region of RASSF6. Peptide sequence FDDLYRISELDRTQIPMSEKRNSQEDYLSYHSNTLKPHAKDEPDSPVLYR. |
| Other Names | DKFZp686K23225, putative RAS binding protein, Ras association (RalGDS/AF-6) domain family 6, Ras association (RalGDS/AF-6) domain family member 6, ras association domain-containing protein 6 |
| Gene, Accession # | RASSF6, Gene ID: 166824, Accession: Q6ZTQ3, SwissProt: Q6ZTQ3 |
| Catalog # | NBP1-68973-20ul |
| Price | |
| Order / More Info | RASSF6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |