| Edit |   |
|---|
| Antigenic Specificity | RASSF10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RASSF10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RASSF10. This antibody reacts with human. The RASSF10 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RRCDDLLRLQEQRVQQEELLERLSAEIQEELNQRWMRRRQEELAAREEPLEPDGGPDGELLLEQERVRTQLSTSLYIGLRLNTDLEA |
|---|
| Other Names | Peptidylglycine Alpha-Amidating Monooxygenase COOH-Terminal Interactor-Like, Ras Association (RalGDS/AF-6) Domain Family (N-Terminal) Member 10, Ras Association Domain-Containing Protein 10 |
|---|
| Gene, Accession # | RASSF10, Gene ID: 644943 |
|---|
| Catalog # | NBP2-68639 |
|---|
| Price | |
|---|
| Order / More Info | RASSF10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|