| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACOX1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACOX1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACOX1. This antibody reacts with human. The ACOX1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ACOX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHEDLNFLTRSQRYEVAVRKSAIMVKKMREFGIADPDEIMWFK |
|---|
| Other Names | ACOXEC 1.3.3.6, acyl-CoA oxidase 1, palmitoyl, acyl-CoA oxidase, straight-chain, acyl-Coenzyme A oxidase 1, palmitoyl, AOX, PALMCOX, Palmitoyl-CoA oxidase, peroxisomal acyl-coenzyme A oxidase 1, peroxisomal fatty acyl-CoA oxidase, SCOXMGC1198, Straight-chain acyl-CoA oxidase |
|---|
| Gene, Accession # | ACOX1, Gene ID: 51, Accession: Q15067 |
|---|
| Catalog # | NBP1-80951 |
|---|
| Price | |
|---|
| Order / More Info | ACOX1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|