| Edit |   |
| Antigenic Specificity | LRRC3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC3. This antibody reacts with human. The LRRC3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LRRC3 (leucine rich repeat containing 3) The peptide sequence was selected from the middle region of LRRC3. Peptide sequence TFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEA. |
| Other Names | C21orf102, chromosome 21 open reading frame 102, leucine rich repeat containing 3, leucine-rich repeat-containing protein 3, LRRC3A |
| Gene, Accession # | LRRC3, Gene ID: 81543, Accession: Q9BY71, SwissProt: Q9BY71 |
| Catalog # | NBP1-70624-20ul |
| Price | |
| Order / More Info | LRRC3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |