| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DGK-alpha |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DGK-alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to DGK-alpha. This antibody reacts with human. The DGK-alpha Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DGK-alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSL |
|---|
| Other Names | DAG kinase alpha, DAGK, DAGK1diacylglycerol kinase, alpha (80kD), DGK-alphaEC 2.7.1.107, diacylglycerol kinase alpha, diacylglycerol kinase, alpha 80kDa, Diglyceride kinase alpha, MGC12821,80 kDa diacylglycerol kinase, MGC42356 |
|---|
| Gene, Accession # | DGKA, Gene ID: 1606 |
|---|
| Catalog # | NBP2-55682 |
|---|
| Price | |
|---|
| Order / More Info | DGK-alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|