| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kindlin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kindlin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kindlin. This antibody reacts with human. The Kindlin Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Kindlin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DSSYQPEVLNILSFLRMKNRNSASQVASSLENMDMNPECFVSPRCAKKHKSKQLA |
|---|
| Other Names | C20orf42fermitin family homolog 1, chromosome 20 open reading frame 42, fermitin family homolog 1 (Drosophila), fermitin family member 1, FLJ20116, KIND1DTGCU2, kindlerin, kindlin 1, Kindlin syndrome protein, Kindlin-1, UNC112 related protein 1, UNC112A, Unc-112-related protein 1, URP1FLJ23423 |
|---|
| Gene, Accession # | FERMT1, Gene ID: 55612 |
|---|
| Catalog # | NBP1-89884 |
|---|
| Price | |
|---|
| Order / More Info | Kindlin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|