| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Axotrophin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Axotrophin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Axotrophin. This antibody reacts with human. The Axotrophin Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Axotrophin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ILPGSLFRFAVPPALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAPSRDPERLQKIK |
|---|
| Other Names | AXO, AXOT, Axotrophin, E3 ubiquitin-protein ligase MARCH7, EC 6.3.2, EC 6.3.2.-, MARCH-VIIDKFZp586F1122, membrane-associated ring finger (C3HC4) 7, Membrane-associated RING finger protein 7, Membrane-associated RING-CH protein VII, RING finger protein 177, RNF177axotrophin |
|---|
| Gene, Accession # | MARCH7, Gene ID: 64844 |
|---|
| Catalog # | NBP1-90057 |
|---|
| Price | |
|---|
| Order / More Info | Axotrophin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 19901269 |
|---|
| 产品资料 |
|
|