| Edit |   |
| Antigenic Specificity | LRRC24 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRC24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC24. This antibody reacts with human. The LRRC24 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LRRC24(leucine rich repeat containing 24) The peptide sequence was selected from the N terminal of LRRC24. Peptide sequence PLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGL. |
| Other Names | leucine rich repeat containing 24, leucine-rich repeat-containing protein 24, MGC111484 |
| Gene, Accession # | LRRC24, Gene ID: 441381 |
| Catalog # | NBP1-70622 |
| Price | |
| Order / More Info | LRRC24 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |