| Edit |   |
| Antigenic Specificity | LRRC20 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRC20 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC20. This antibody reacts with human. The LRRC20 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LRRC20(leucine rich repeat containing 20) The peptide sequence was selected from the middle region of LRRC20. Peptide sequence TTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALP. |
| Other Names | FLJ10751, FLJ10844, leucine rich repeat containing 20, leucine-rich repeat-containing protein 20 |
| Gene, Accession # | LRRC20, Gene ID: 55222, Accession: Q8TCA0, SwissProt: Q8TCA0 |
| Catalog # | NBP1-56883 |
| Price | |
| Order / More Info | LRRC20 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |