| Edit |   |
| Antigenic Specificity | LRRC17 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRC17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC17. This antibody reacts with human. The LRRC17 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to LRRC17(leucine rich repeat containing 17) The peptide sequence was selected from the middle region of LRRC17. Peptide sequence YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL. |
| Other Names | 37 kDa leucine-rich repeat (LRR) protein, leucine rich repeat containing 17, leucine-rich repeat-containing protein 17, p37NB, P37NBH_RG318M05.3 |
| Gene, Accession # | LRRC17, Gene ID: 10234, Accession: Q8N6Y2, SwissProt: Q8N6Y2 |
| Catalog # | NBP1-55529-20ul |
| Price | |
| Order / More Info | LRRC17 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |