| Edit |   |
|---|
| Antigenic Specificity | LRRC15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRC15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC15. This antibody reacts with human. The LRRC15 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human LRRC15 (NP_570843). Peptide sequence LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG. |
|---|
| Other Names | hLib, leucine rich repeat containing 15 |
|---|
| Gene, Accession # | LRRC15, Gene ID: 131578, Accession: Q8TF66, SwissProt: Q8TF66 |
|---|
| Catalog # | NBP1-91365 |
|---|
| Price | |
|---|
| Order / More Info | LRRC15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|