| Edit |   |
|---|
| Antigenic Specificity | LRRC14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRC14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC14. This antibody reacts with human. The LRRC14 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human LRRC14. Peptide sequence ELLRDSVAQAELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVE. |
|---|
| Other Names | KIAA0014LRRC14A, leucine rich repeat containing 14, leucine-rich repeat-containing protein 14 |
|---|
| Gene, Accession # | LRRC14, Gene ID: 9684, Accession: NP_055480, SwissProt: NP_055480 |
|---|
| Catalog # | NBP1-80049 |
|---|
| Price | |
|---|
| Order / More Info | LRRC14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|