| Edit |   |
|---|
| Antigenic Specificity | AXDND1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AXDND1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AXDND1. This antibody reacts with human. The AXDND1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human AXDND1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DNGYSKILPSLISSLDFCSFKLENLEFPDTPLEEWQEIDEKINEMKSHLDILLNLTGIVPQHIDVDSVSVLQAYIFNMIQQWLLKIGNEINNGN |
|---|
| Other Names | axonemal dynein light chain domain containing 1, axonemal dynein light chain domain-containing protein 1, C1orf125 |
|---|
| Gene, Accession # | AXDND1, Gene ID: 126859 |
|---|
| Catalog # | NBP2-49645 |
|---|
| Price | |
|---|
| Order / More Info | AXDND1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|