| Edit |   |
|---|
| Antigenic Specificity | AWAT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AWAT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AWAT2. This antibody reacts with human, mouse. The AWAT2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human DGAT2L4. Peptide sequence GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII. |
|---|
| Other Names | acyl-CoA wax alcohol acyltransferase 2 |
|---|
| Gene, Accession # | AWAT2, Gene ID: 158835, Accession: NP_001002254, SwissProt: NP_001002254 |
|---|
| Catalog # | NBP1-91574 |
|---|
| Price | |
|---|
| Order / More Info | AWAT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28096191 |
|---|