| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GnRH |
|---|
| Clone | 4H3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GnRH Antibody (4H3) from Novus Biologicals is a mouse monoclonal antibody to GnRH. This antibody reacts with human. The GnRH Antibody (4H3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | GNRH1 (NP_000816, 24 a.a. - 92 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI |
|---|
| Other Names | GNRH, GnRH-associated peptide 1, gonadotropin-releasing hormone 1 (leutinizing-releasing hormone), gonadotropin-releasing hormone 1 (luteinizing-releasing hormone), GRH, LHRH, LNRH, luliberin I, Progonadoliberin I, progonadoliberin-1, prolactin release-inhibiting factor |
|---|
| Gene, Accession # | GNRH1, Gene ID: 2796, Accession: NP_000816, SwissProt: NP_000816 |
|---|
| Catalog # | H00002796-M01 |
|---|
| Price | |
|---|
| Order / More Info | GnRH Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|