| 产品详情 |
| Edit |   |
| Antigenic Specificity | GNL3L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GNL3L Antibody from Novus Biologicals is a rabbit polyclonal antibody to GNL3L. This antibody reacts with human, mouse, rat. The GNL3L Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat GNL3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKEMTEVFDIED |
| Other Names | EC 3.6.1, FLJ10613, guanine nucleotide binding protein-like 3 (nucleolar)-like, guanine nucleotide-binding protein-like 3-like protein, novel GTPase |
| Gene, Accession # | GNL3L, Gene ID: 54552 |
| Catalog # | NBP1-84618 |
| Price | |
| Order / More Info | GNL3L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24201379 |
| 产品资料 |
|
|