| Edit |   |
|---|
| Antigenic Specificity | GNGT1 |
|---|
| Clone | 1F8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GNGT1 Antibody (1F8) from Novus Biologicals is a mouse monoclonal antibody to GNGT1. This antibody reacts with human. The GNGT1 Antibody (1F8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | GNGT1 (AAH29367, 1 a.a. - 74 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS |
|---|
| Other Names | GNG1, guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 1, guanine nucleotide-binding protein G(T) subunit gamma-T1, Transducin gamma chain |
|---|
| Gene, Accession # | GNGT1, Gene ID: 2792, Accession: AAH29367, SwissProt: AAH29367 |
|---|
| Catalog # | H00002792-M01 |
|---|
| Price | |
|---|
| Order / More Info | GNGT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|