| 产品详情 |
| Edit |   |
| Antigenic Specificity | EMMPRIN/CD147 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EMMPRIN/CD147 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EMMPRIN/CD147. This antibody reacts with human. The EMMPRIN/CD147 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human EMMPRIN/CD147 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGT |
| Other Names | 5F7, basigin, basigin (Ok blood group), CD147, CD147 antigen, Collagenase stimulatory factor, EMMPRINTCSF, Extracellular matrix metalloproteinase inducer, Leukocyte activation antigen M6, M6, OK, OK blood group antigen, Tumor cell-derived collagenase stimulatory factor |
| Gene, Accession # | BSG, Gene ID: 682 |
| Catalog # | NBP2-57810 |
| Price | |
| Order / More Info | EMMPRIN/CD147 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|