| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EMID2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EMID2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EMID2. This antibody reacts with human. The EMID2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EMID2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acid sequence: ANLVSYRTLIRPTYRVSYRTVTVLEWRCCPGFTGSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVP |
|---|
| Other Names | COL26A1, EMI domain containing 2, EMI domain-containing protein 2, Emilin and multimerin domain-containing protein 2, emilin and multimerin-domain containing protein 2, EMU2, Emu2type XXVI, alpha 1, hEmu2, KIAA1299, MGC129848, putative emu2, SH2B, SH2B1 |
|---|
| Gene, Accession # | EMID2, Gene ID: 136227 |
|---|
| Catalog # | NBP2-59788 |
|---|
| Price | |
|---|
| Order / More Info | EMID2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|