| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRPM1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRPM1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRPM1. This antibody reacts with human. The TRPM1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TRPM1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CEATYLLRQSSINSADGYSLYRYHFNGEELLFEDTSLSTSPGTGVRKKTCSFRIKEEKDVKTHLVPECQNSLHLSLGTSTSATPDGSHLAVDDLKNAEESKLGPDIGISKEDD |
|---|
| Other Names | CSNB1C, Long transient receptor potential channel 1, LTrpC1, LTRPC1transient receptor potential cation channel subfamily M member 1, melastatin 1, melastatin-1, MLSN, MLSN1transient receptor potential melastatin family, transient receptor potential cation channel, subfamily M, member 1 |
|---|
| Gene, Accession # | TRPM1, Gene ID: 4308 |
|---|
| Catalog # | NBP2-58415 |
|---|
| Price | |
|---|
| Order / More Info | TRPM1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|