| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HIST1H3D |
|---|
| Clone | 1D8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | IgG3 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HIST1H3D Antibody (1D8) from Novus Biologicals is a mouse monoclonal antibody to HIST1H3D. This antibody reacts with human, mouse. The HIST1H3D Antibody (1D8) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | HIST1H3D (NP_003521, 1 a.a. - 60 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE |
|---|
| Other Names | H3 histone family, member L, H3/l, H3FA, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FLHIST1H3E, HIST1H3A, HIST1H3C, HIST1H3D, HIST1H3F, HIST1H3G, HIST1H3H, HIST1H3I, HIST1H3J, histone 1, H3b, histone cluster 1, H3b, histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l |
|---|
| Gene, Accession # | HIST1H3D, Gene ID: 8351, Accession: NP_003521, SwissProt: NP_003521 |
|---|
| Catalog # | H00008351-M01 |
|---|
| Price | |
|---|
| Order / More Info | HIST1H3D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22754361 |
|---|
| 产品资料 |
|
|