| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Sulfatase Modifying Factor 2/SUMF2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sulfatase Modifying Factor 2/SUMF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sulfatase Modifying Factor 2/SUMF2. This antibody reacts with human. The Sulfatase Modifying Factor 2/SUMF2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Sulfatase Modifying Factor 2/SUMF2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLP |
|---|
| Other Names | C-alpha-formyglycine-generating enzyme 2, C-alpha-formylglycine-generating enzyme 2, DKFZp566I1024, DKFZp686I1024, DKFZp686L17160, DKFZp781L1035, MGC99485, paralog of the formylglycine-generating enzyme, pFGE, sulfatase modifying factor 2, sulfatase-modifying factor 2 |
|---|
| Gene, Accession # | SUMF2, Gene ID: 25870 |
|---|
| Catalog # | NBP1-84145 |
|---|
| Price | |
|---|
| Order / More Info | Sulfatase Modifying Factor 2/SUMF2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|