| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Sulfatase Modifying Factor 1/SUMF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sulfatase Modifying Factor 1/SUMF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sulfatase Modifying Factor 1/SUMF1. This antibody reacts with human, mouse, rat. The Sulfatase Modifying Factor 1/SUMF1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat Sulfatase Modifying Factor 1/SUMF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHR |
|---|
| Other Names | AAPA3037, EC 1.8.99.-, FGEC-alpha-formylglycine-generating enzyme 1, FGly-generating enzyme, MGC131853, MGC150436, sulfatase modifying factor 1, sulfatase-modifying factor 1, UNQ3037 |
|---|
| Gene, Accession # | SUMF1, Gene ID: 285362 |
|---|
| Catalog # | NBP1-83905 |
|---|
| Price | |
|---|
| Order / More Info | Sulfatase Modifying Factor 1/SUMF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|