| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protein O-Glucosyltransferase 1/POGLUT1/KTELC1. This antibody reacts with human. The Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDLTPFRGGISRKMMAEVVRRKLGTHYQITKNRLYRENDCMFPSRCSGVEHFIL |
|---|
| Other Names | 9630046K23Rik, C3orf9, CAP10-like protein, 46 kDa, chromosome 3 open reading frame 9, CLP46, EC 2.4.1.-, hCLP46CAP10-like 46 kDa protein, KDELC family like 1, KDELCL1, KTEL (Lys-Tyr-Glu-Leu) containing 1, KTEL motif-containing protein 1, MDS010, MDSRPKTELC1, MGC32995, Myelodysplastic syndromes relative protein, protein O-glucosyltransferase 1, Rumi, x 010 protein |
|---|
| Gene, Accession # | POGLUT1, Gene ID: 56983 |
|---|
| Catalog # | NBP2-68633 |
|---|
| Price | |
|---|
| Order / More Info | Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|