| Edit |   |
|---|
| Antigenic Specificity | Protein O-Fucosyltransferase 1/POFUT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Protein O-Fucosyltransferase 1/POFUT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protein O-Fucosyltransferase 1/POFUT1. This antibody reacts with human. The Protein O-Fucosyltransferase 1/POFUT1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to POFUT1 (protein O-fucosyltransferase 1) The peptide sequence was selected form the middle region of POFUT1. Peptide sequence RVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGP. |
|---|
| Other Names | FUT12EC 2.4.1.221, GDP-fucose protein O-fucosyltransferase 1, KIAA0180MGC2482, o-fucosyltransferase protein, O-Fuc-T, O-FucT-1, O-FUT, Peptide-O-fucosyltransferase 1, protein O-fucosyltransferase 1 |
|---|
| Gene, Accession # | POFUT1, Gene ID: 23509, Accession: Q6EV69, SwissProt: Q6EV69 |
|---|
| Catalog # | NBP1-69196 |
|---|
| Price | |
|---|
| Order / More Info | Protein O-Fucosyltransferase 1/POFUT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|