| Edit |   |
|---|
| Antigenic Specificity | Protein mab-21-like 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Protein mab-21-like 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protein mab-21-like 1. This antibody reacts with human. The Protein mab-21-like 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MAB21L1(mab-21-like 1 (C. elegans)) The peptide sequence was selected from the N terminal of MAB21L1. Peptide sequence IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR. |
|---|
| Other Names | CAGR1mab-21 (C. elegans)-like 1, FLJ10197, mab-21-like 1 (C. elegans), mab-21-like protein 1, protein mab-21-like 1 |
|---|
| Gene, Accession # | MAB21L1, Gene ID: 4081, Accession: Q13394, SwissProt: Q13394 |
|---|
| Catalog # | NBP1-55246 |
|---|
| Price | |
|---|
| Order / More Info | Protein mab-21-like 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|