| 产品详情 |
| Edit |   |
| Antigenic Specificity | Protein kinase-like protein SgK493 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Protein kinase-like protein SgK493 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protein kinase-like protein SgK493. This antibody reacts with human. The Protein kinase-like protein SgK493 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Protein kinase-like protein SgK493 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLD |
| Other Names | EC 2.7, FLJ18197, MGC125960, protein kinase domain containing, cytoplasmic homolog (mouse), protein kinase domain-containing protein, cytoplasmic, Protein kinase-like protein SgK493, SgK493, Sugen kinase 493, Vertebrate lonesome kinase, Vlk |
| Gene, Accession # | PKDCC, Gene ID: 91461, Accession: Q504Y2 |
| Catalog # | NBP1-80757 |
| Price | |
| Order / More Info | Protein kinase-like protein SgK493 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|