| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FUNDC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FUNDC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FUNDC2. This antibody reacts with human. The FUNDC2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FUNDC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAASSQGNFEGDIESVDLAEFAKQQPWWRKLFGPESGLSAEKYSVATHLFIG |
|---|
| Other Names | cervical cancer oncogene 3, Cervical cancer proto-oncogene 3 protein, DC44, FLJ33773, FUN14 domain containing 2, FUN14 domain-containing protein 2, HCBP6MGC131676, HCC3, HCC-3, Hepatitis C virus core-binding protein 6, MGC2495, PD03104 |
|---|
| Gene, Accession # | FUNDC2, Gene ID: 65991, Accession: Q9BWH2, SwissProt: Q9BWH2 |
|---|
| Catalog # | NBP2-31745 |
|---|
| Price | |
|---|
| Order / More Info | FUNDC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|