| Edit |   |
|---|
| Antigenic Specificity | FUNDC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FUNDC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FUNDC1. This antibody reacts with human. The FUNDC1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FUNDC1(FUN14 domain containing 1) The peptide sequence was selected from the middle region of FUNDC1. Peptide sequence TAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINN. |
|---|
| Other Names | FUN14 domain containing 1, FUN14 domain-containing protein 1, MGC51029 |
|---|
| Gene, Accession # | FUNDC1, Gene ID: 139341, Accession: Q8IVP5, SwissProt: Q8IVP5 |
|---|
| Catalog # | NBP1-56430 |
|---|
| Price | |
|---|
| Order / More Info | FUNDC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|