| Edit |   |
|---|
| Antigenic Specificity | Fumarylacetoacetate hydrolase |
|---|
| Clone | 3G2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein with GST tag on ELISA. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fumarylacetoacetate hydrolase Antibody (3G2) from Novus Biologicals is a mouse monoclonal antibody to Fumarylacetoacetate hydrolase. This antibody reacts with human. The Fumarylacetoacetate hydrolase Antibody (3G2) has been validated for the following applications: ELISA. |
|---|
| Immunogen | FAH (AAH02527.1, 1 a.a. - 70 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQDVFNQPTLNSF |
|---|
| Other Names | beta-diketonase, EC 3.7.1.2, FAA, fumarylacetoacetase, Fumarylacetoacetate hydrolase, fumarylacetoacetate hydrolase (fumarylacetoacetase) |
|---|
| Gene, Accession # | FAH, Gene ID: 2184, Accession: AAH02527, SwissProt: AAH02527 |
|---|
| Catalog # | H00002184-M01 |
|---|
| Price | |
|---|
| Order / More Info | Fumarylacetoacetate hydrolase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|