| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Fucosyltransferase 7/FUT7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fucosyltransferase 7/FUT7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fucosyltransferase 7/FUT7. This antibody reacts with human. The Fucosyltransferase 7/FUT7 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Fucosyltransferase 7/FUT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRATYEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA |
|---|
| Other Names | alpha-(1,3)-fucosyltransferase, EC 2.4.1, EC 2.4.1.-, EC 2.4.1.65, Fucosyltransferase 7, fucosyltransferase 7 (alpha (1,3) fucosyltransferase), Fucosyltransferase VII, fuc-TVII, FucT-VII, Galactoside 3-L-fucosyltransferase, Selectin ligand synthase, selectin-ligand synthase |
|---|
| Gene, Accession # | FUT7, Gene ID: 2529 |
|---|
| Catalog # | NBP2-55228 |
|---|
| Price | |
|---|
| Order / More Info | Fucosyltransferase 7/FUT7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|