| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Fucosyltransferase 5/FUT5 |
|---|
| Clone | 1H6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fucosyltransferase 5/FUT5 Antibody (1H6) from Novus Biologicals is a mouse monoclonal antibody to Fucosyltransferase 5/FUT5. This antibody reacts with human. The Fucosyltransferase 5/FUT5 Antibody (1H6) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | FUT5 (NP_002025, 95 a.a. - 164 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDG |
|---|
| Other Names | alpha (1,3) fucosyltransferase, alpha-(1,3)-fucosyltransferase, EC 2.4.1, EC 2.4.1.65, Fucosyltransferase 5, fucosyltransferase 5 (alpha (1,3) fucosyltransferase), Fucosyltransferase V, fucT-V, Fuc-TV, Galactoside 3-L-fucosyltransferase |
|---|
| Gene, Accession # | FUT5, Gene ID: 2527, Accession: NP_002025, SwissProt: NP_002025 |
|---|
| Catalog # | H00002527-M03 |
|---|
| Price | |
|---|
| Order / More Info | Fucosyltransferase 5/FUT5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|