| Edit |   |
| Antigenic Specificity | Fucosyltransferase 3/FUT3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Fucosyltransferase 3/FUT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fucosyltransferase 3/FUT3. This antibody reacts with human. The Fucosyltransferase 3/FUT3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is FUT3/Blood Group Lewis A - C-terminal region. Peptide Sequence: DKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAW |
| Other Names | n/a |
| Gene, Accession # | FUT3, Gene ID: 2525, Accession: NP_000140, SwissProt: NP_000140 |
| Catalog # | NBP1-98489 |
| Price | |
| Order / More Info | Fucosyltransferase 3/FUT3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |