| Edit |   |
|---|
| Antigenic Specificity | Fucosyltransferase 3/FUT3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fucosyltransferase 3/FUT3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fucosyltransferase 3/FUT3. This antibody reacts with human. The Fucosyltransferase 3/FUT3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is FUT3/Blood Group Lewis A - C-terminal region. Peptide Sequence: DKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAW |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | FUT3, Gene ID: 2525, Accession: NP_000140, SwissProt: NP_000140 |
|---|
| Catalog # | NBP1-98489-20ul |
|---|
| Price | |
|---|
| Order / More Info | Fucosyltransferase 3/FUT3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|