| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ryanodine Receptor 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ryanodine Receptor 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ryanodine Receptor 1. This antibody reacts with human. The Ryanodine Receptor 1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Ryanodine Receptor 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK |
|---|
| Other Names | CCO, central core disease of muscle, MHS, MHS1, ryanodine receptor 1, ryanodine receptor 1 (skeletal), ryanodine receptor type1, RYDR, RYR, RyR1, RYR-1, sarcoplasmic reticulum calcium release channel, Skeletal muscle calcium release channel, skeletal muscle ryanodine receptor, Skeletal muscle-type ryanodine receptor, SKRR, type 1-like ryanodine receptor |
|---|
| Gene, Accession # | RYR1, Gene ID: 6261, Accession: P21817, SwissProt: P21817 |
|---|
| Catalog # | NBP2-33785 |
|---|
| Price | |
|---|
| Order / More Info | Ryanodine Receptor 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|