| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ELK3 |
|---|
| Clone | 3A12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ELK3 Antibody (3A12) from Novus Biologicals is a mouse monoclonal antibody to ELK3. This antibody reacts with human. The ELK3 Antibody (3A12) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ELK3 (NP_005221.2, 101 a.a. - 200 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVS |
|---|
| Other Names | ELK3, ETS-domain protein (SRF accessory protein 2), ERPETS domain-containing protein Elk-3, ETS-domain protein, ETS-related protein ERP, NETSRF accessory protein 2, SAP-2, SAP2ETS-related protein NET, Serum response factor accessory protein 2 |
|---|
| Gene, Accession # | ELK3, Gene ID: 2004, Accession: NP_005221, SwissProt: NP_005221 |
|---|
| Catalog # | H00002004-M02 |
|---|
| Price | |
|---|
| Order / More Info | ELK3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|