| Edit |   |
|---|
| Antigenic Specificity | Elf4/MEF |
|---|
| Clone | 1E10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 lambda |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Elf4/MEF Antibody (1E10) from Novus Biologicals is a mouse monoclonal antibody to Elf4/MEF. This antibody reacts with human. The Elf4/MEF Antibody (1E10) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ELF4 (NP_001412, 521 a.a. - 612 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPV |
|---|
| Other Names | E74-like factor 4, E74-like factor 4 (ets domain transcription factor), ETS-related transcription factor Elf-4, MEFELFRMyeloid Elf-1-like factor |
|---|
| Gene, Accession # | ELF4, Gene ID: 2000, Accession: NP_001412, SwissProt: NP_001412 |
|---|
| Catalog # | H00002000-M02 |
|---|
| Price | |
|---|
| Order / More Info | Elf4/MEF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|