| Edit |   |
|---|
| Antigenic Specificity | FOXL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 82%, rat 79%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human FOXL2 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGG |
|---|
| Other Names | forkhead box L2, BPES, BPES1 |
|---|
| Gene, Accession # | Gene ID: 668, UniProt: P58012, ENSG00000183770 |
|---|
| Catalog # | HPA069613 |
|---|
| Price | |
|---|
| Order / More Info | FOXL2 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|